PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.2G309500.4.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family Nin-like
Protein Properties Length: 854aa    MW: 93413.7 Da    PI: 6.7125
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.2G309500.4.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK91.47e-29536587152
              RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                         aek++sl++l++yF++++kdAA++Lgvc+T+LKriCRq+GI RWP+Rkik++
  Sevir.2G309500.4.p 536 AEKTVSLQVLRQYFAGSLKDAARSLGVCPTTLKRICRQHGITRWPSRKIKKV 587
                         5899**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.746524607IPR003035RWP-RK domain
PfamPF020422.4E-25539587IPR003035RWP-RK domain
SuperFamilySSF542775.23E-22745842No hitNo description
Gene3DG3DSA:3.10.20.2403.9E-25751836No hitNo description
SMARTSM006664.4E-19755838IPR000270PB1 domain
PROSITE profilePS5174521.372755838IPR000270PB1 domain
CDDcd064079.43E-42756836No hitNo description
PfamPF005641.1E-15756836IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 854 aa     Download sequence    Send to blast
MEEGGGDPQP SFSLQARTPS EGGAAVDLDL LEQLLSGDNG WFDVVSRSPN SLASPPPAAF  60
FSADVTAAAV TTTSSSTQAA SSWWIQTGGA SPSSVRDRFS QALSYIRETQ SDGDVLVQLW  120
VPVSRGDGRL VLTTSGQPFT LDQSSDSLIR FREVSTKYQF SADVKSGDSP GLPGRVFIGR  180
LPEWSPDVRY FTTYEYPRVR DAQYLDVHGT MGLPVFEKGS YNCLGVIELI MTRQKLNFTS  240
ELNTICSALQ AVNLRSAEVS SVPRVQFSTA SYKNALPEIL EVLRAACLTH KLPLAQTWVT  300
CAQQGKRGSR HSDENYPYCI STIDEACFVN EPEMQDFHDA CSEHHLLRGQ GVAGKAFTTN  360
QPCFLPDIGS SAKLDYPLSH HAKIFKLKGA VAIRLRCTRT GTADFVLEFF LPTDCQALEE  420
QKEVLDSLSG TMRSVCQTLR VVTDKEMEDE AMWETNELNS FTPQGKNKAE ELSFGGNSAD  480
RRGEASWTSL AETSQQESEL AALRMHGMFS SGGQGPSLSG VQSAAEGSKA KRRTKAEKTV  540
SLQVLRQYFA GSLKDAARSL GVCPTTLKRI CRQHGITRWP SRKIKKVDHS LRKLQQIIDS  600
VHGAETSFQL NTLYKDLTNT SISSENNLSG SMTIPPTNQS NLTDFDKHQH HKSNSIVPST  660
SPSHSSCSHN SDSSPSCSGG ARKHAPQGII DLMKSGNPVK DSPIQTLQTE NTSLYEHFSV  720
HEAPTDLLQD VTEKANGGLH SSRSPSSPKQ NAEANMRVKA TFGSEKVRFR LNPKCDFQEL  780
KHEIAKRLSI VDTSSLILKY LDDDSEWVLM TCDADLQECF HVYKLADIQT IKISVHLAVS  840
PATRVTTGPT GLS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004957563.10.0PREDICTED: protein NLP1 isoform X2
RefseqXP_004957564.10.0PREDICTED: protein NLP1 isoform X2
TrEMBLK3ZQN50.0K3ZQN5_SETIT; Uncharacterized protein
STRINGSi028915m0.0(Setaria italica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76350.10.0Nin-like family protein